PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C006159P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family M-type_MADS
Protein Properties Length: 110aa    MW: 12506.4 Da    PI: 10.7092
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C006159P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF96.31.3e-301059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rien + rqvtfskRrng+lKKA+ELSvLCdae+a+iifss+gklye+ss
  MELO3C006159P1 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEIALIIFSSRGKLYEFSS 59
                    8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.945161IPR002100Transcription factor, MADS-box
SMARTSM004322.0E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-34383IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002654.70E-45378No hitNo description
PRINTSPR004041.5E-31323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000060Biological Processprotein import into nucleus, translocation
GO:0009409Biological Processresponse to cold
GO:0009739Biological Processresponse to gibberellin
GO:0009911Biological Processpositive regulation of flower development
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005737Cellular Componentcytoplasm
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MVRGKTQMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEIALIIFSS RGKLYEFSSS  60
SMQATVERYL RHTRSNQSHH LDQLSAHQPD LQSVQVCPML ERNINASLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D6e-22380276MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C6e-22380276MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B6e-22380276MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A6e-22380276MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J8e-22380276Myocyte-specific enhancer factor 2A
3p57_I8e-22380276Myocyte-specific enhancer factor 2A
3p57_D8e-22380276Myocyte-specific enhancer factor 2A
3p57_C8e-22380276Myocyte-specific enhancer factor 2A
3p57_B8e-22380276Myocyte-specific enhancer factor 2A
3p57_A8e-22380276Myocyte-specific enhancer factor 2A
3kov_J8e-22380276Myocyte-specific enhancer factor 2A
3kov_I8e-22380276Myocyte-specific enhancer factor 2A
3kov_B8e-22380276Myocyte-specific enhancer factor 2A
3kov_A8e-22380276Myocyte-specific enhancer factor 2A
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00076ChIP-chipTransfer from AT2G45660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818487e-97LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132607e-97LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008438119.13e-64PREDICTED: MADS-box protein SOC1-like isoform X2
SwissprotO646455e-43SOC1_ARATH; MADS-box protein SOC1
TrEMBLA0A0B2P6571e-43A0A0B2P657_GLYSO; MADS-box protein SOC1
TrEMBLA1XG541e-43A1XG54_SOYBN; SOC1
STRINGGLYMA18G45780.13e-43(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.13e-44AGAMOUS-like 20